Recombinant Mouse a-2-HS-Glycoprotein//AHSG/Fetuin A (C-10His)

Source: Human Cells. MW :36.7kD. Recombinant Mouse Fetuin A is produced by our Mammalian expression system and the target gene encoding Ala19-Ile345 is expressed with a 10His tag at the N-terminus. Alpha-2-HS-glycoprotein (AHSG) is a glycoprotein that is composed of two subunits, the A and B chains, belongs to the Cystatin family of proteases inhibitors. It is highly expressed in embryonic cells and adult hepatocytes, and is expressed to a lesser extent in monocytes/macrophages. AHSG is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. In addition, AHSG may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages. ASHG blocks TGF-beta-dependent signaling in osteoblastic cells.

Product Specifications

Gene Name

Ahsg

Gene ID

11625

UniProt

P29699

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKIHHHHHHHHHH