Recombinant Mouse S100 Calcium Binding Protein A15A/S100A15A
Source: E.coli. MW :12.9kD. Recombinant Mouse S100 calcium binding protein A15A is produced by our E.coli expression system and the target gene encoding Met1-Tyr108 is expressed.
Product Specifications
Gene Name
S100a15a
Gene ID
381493
UniProt
Q6S5I3
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
