Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD3 e/CD3E (C-Fc)

Source: Human Cells. MW :38.7kD. Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a Fc tag at the C-terminus. T-Cell Surface Glycoprotein CD3 e Chain (CD3e) is a single-pass type I membrane protein. CD3e contains 1 Ig-like (immunoglobulin-like) domain and 1 ITAM domain. CD3e is a polypeptide encoded by the CD3E gene on chromosome 11 in humans. The T cell receptor-CD3 complex (TCR/CD3 complex) is involved in T-cell development and several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs (ITAMs) . TCR/CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.

Product Specifications

Gene Name

CD3E

Gene ID

916

UniProt

P07766

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Akr7a2 (NM_134407) Rat Tagged ORF Clone Lentiviral Particle
RR200557L3V 200 µL

Akr7a2 (NM_134407) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
FAM78B (Protein FAM78B, Family with Sequence Similarity 78, Member B)
480787 100 µL

FAM78B (Protein FAM78B, Family with Sequence Similarity 78, Member B)

Ask
View Details
Keratin 15 (KRT15, CK15, CK-15, Cytokeratin-15, K15, K1CO, Keratin, type I cytoskeletal 15, KRTB) (BSA & Azide Free) (MaxLight 405) discontinued. See K0199-18
K0199-18X-ML405 100 µL

Keratin 15 (KRT15, CK15, CK-15, Cytokeratin-15, K15, K1CO, Keratin, type I cytoskeletal 15, KRTB) (BSA & Azide Free) (MaxLight 405) discontinued. See K0199-18

Ask
View Details
Mouse Transmembrane protein 120B, Tmem120b ELISA KIT
ELI-41660m 96 Tests

Mouse Transmembrane protein 120B, Tmem120b ELISA KIT

Ask
View Details
PerCP/Cyanine5.5 anti-mouse CD206 (MMR)
GT04484 25 µg

PerCP/Cyanine5.5 anti-mouse CD206 (MMR)

Ask
View Details
Cathepsin C (Dipeptidyl Peptidase 1, Cathepsin C, Cathepsin J, Dipeptidyl Peptidase I, DPP-I, DPPI, Dipeptidyl Transferase, CPPI)
124373 100 µg

Cathepsin C (Dipeptidyl Peptidase 1, Cathepsin C, Cathepsin J, Dipeptidyl Peptidase I, DPP-I, DPPI, Dipeptidyl Transferase, CPPI)

Ask
View Details