Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human KIR2DL3/NKAT2/CD158b2 (C-Fc)

Source: Human Cells. MW :51.7kD. Recombinant Human KIR2DL3 is produced by our Mammalian expression system and the target gene encoding His22-His245 is expressed with a Fc tag at the C-terminus. Killer-Cell Immunoglobulin-Like Receptors (KIRs) are important cells of the immune system. KIRs are a family of Natural Killer (NK) Cells surface glycoproteins. KIRs control the killing function of these cells by interacting with MHC class I molecules. This interaction allows KIRs to identify virally infected cells or tumor cells by the distinctive low level of Class I MHC on their surface. The majority of KIRs are inhibitory, their recognition of MHC suppresses the cytotoxic activity of their NK cell. Only a limited number of KIRs have the capacity to activate cells. KIR2DL3 is an inhibitory Killer Cell Ig-like Receptor. KIR2DL3 recognizes class I MHC molecules (HLA-Cw1, -Cw3, -Cw7, and Cw8) . KIR2DL3 inhibits the activity of NK cells thus preventing cell lysis.

Product Specifications

Gene Name

KIR2DL3

Gene ID

3804

UniProt

P43628

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal Podoplanin Antibody (PDPN/8950R) [Janelia Fluor 525]
NBP3-24169JF525 0.1 mL

Rabbit Monoclonal Podoplanin Antibody (PDPN/8950R) [Janelia Fluor 525]

Ask
View Details
TRSPAP1 (TRNAU1AP) Rabbit Polyclonal Antibody
TA382856 100 µL

TRSPAP1 (TRNAU1AP) Rabbit Polyclonal Antibody

Ask
View Details
EGFP/EYFP-Tag (GF, Green Fluorescent Protein, enhanced Green Fluorescent Protein) (MaxLight 750) discontinued
302408-ML750 100 µL

EGFP/EYFP-Tag (GF, Green Fluorescent Protein, enhanced Green Fluorescent Protein) (MaxLight 750) discontinued

Ask
View Details
KIRREL2 (Kin of IRRE Like 2)
588493 50 µg

KIRREL2 (Kin of IRRE Like 2)

Ask
View Details
pCMV-SPORT6-MORN5 Plasmid
PVT33925 2 µg

pCMV-SPORT6-MORN5 Plasmid

Ask
View Details
Rabbit Monoclonal Factor IX Antibody (034) [CoraFluor 1]
NBP2-89906CL1 0.1 mL

Rabbit Monoclonal Factor IX Antibody (034) [CoraFluor 1]

Ask
View Details