Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human KIR2DL3/NKAT2/CD158b2 (C-Fc)

Source: Human Cells. MW :51.7kD. Recombinant Human KIR2DL3 is produced by our Mammalian expression system and the target gene encoding His22-His245 is expressed with a Fc tag at the C-terminus. Killer-Cell Immunoglobulin-Like Receptors (KIRs) are important cells of the immune system. KIRs are a family of Natural Killer (NK) Cells surface glycoproteins. KIRs control the killing function of these cells by interacting with MHC class I molecules. This interaction allows KIRs to identify virally infected cells or tumor cells by the distinctive low level of Class I MHC on their surface. The majority of KIRs are inhibitory, their recognition of MHC suppresses the cytotoxic activity of their NK cell. Only a limited number of KIRs have the capacity to activate cells. KIR2DL3 is an inhibitory Killer Cell Ig-like Receptor. KIR2DL3 recognizes class I MHC molecules (HLA-Cw1, -Cw3, -Cw7, and Cw8) . KIR2DL3 inhibits the activity of NK cells thus preventing cell lysis.

Product Specifications

Gene Name

KIR2DL3

Gene ID

3804

UniProt

P43628

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NTMT1 Protein (N-cleavage, Human)
P527234 100 µg

NTMT1 Protein (N-cleavage, Human)

Ask
View Details
Lsm4 (NM_015816) Mouse Tagged ORF Clone
MR200855 10 µg

Lsm4 (NM_015816) Mouse Tagged ORF Clone

Ask
View Details
DDDDK-Tag (binds to flag sequnence) rabbit pAb
ES1078-01 50 µL

DDDDK-Tag (binds to flag sequnence) rabbit pAb

Ask
View Details
DDDDK-Tag (binds to flag sequnence) rabbit pAb
ES1078-02 100 µL

DDDDK-Tag (binds to flag sequnence) rabbit pAb

Ask
View Details
LRRC61 (NM_001142928) Human Recombinant Protein
PH33352M5 20 µg

LRRC61 (NM_001142928) Human Recombinant Protein

Ask
View Details
PRB4 Rabbit pAb (APR23294N)
APR23294N-01 50 µL

PRB4 Rabbit pAb (APR23294N)

Ask
View Details