Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aldehyde Dehydrogenase 1-A2/ALDH1A2 (N-6His)

Source: E.coli. MW :58.2kD. Recombinant Human Aldehyde dehydrogenase 1-A2 is produced by our E.coli expression system and the target gene encoding Met1-Ser518 is expressed with a 6His tag at the N-terminus. Aldehyde dehydrogenase 1 family member A2 (ALDH1A2), also known as retinaldehyde dehydrogenase 2 (RALDH2), belongs to the aldehyde dehydrogenase family which contains two members, the ALDH1 s (ALDH1A1, ALDH1A2 and ALDH1A3) and the 9-cis retinaldehyde dehydrogenase ALDH8 s. ALDH1A2 is key enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. RA is a paracrine hormone signaling molecule that functions in developing and adult tissues. ALDH1A2 was also found to regulate normal and tumor cell growth and differentiation. Several studies showed that ALDH1A2 expression is increased after the appearance of AraC resistance in clinical cases which means this protein is effective in AraC resistance.

Product Specifications

Gene Name

ALDH1A2

Gene ID

8854

UniProt

O94788

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mMNaCl, pH7.5,20% Glycerol.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Olfr1217 (NM_146901) Mouse Tagged ORF Clone
MR215565 10 µg

Olfr1217 (NM_146901) Mouse Tagged ORF Clone

Ask
View Details
UBE3A CRISPRa sgRNA lentivector (set of three targets)(Human)
49015121 3x 1.0µg DNA

UBE3A CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
MALAT1-IN-1
MBS3843282-01 10 mg

MALAT1-IN-1

Ask
View Details
MALAT1-IN-1
MBS3843282-02 5x 10 mg

MALAT1-IN-1

Ask
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Argininosuccinate synthase (argG)
MBS1019552-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Argininosuccinate synthase (argG)

Ask
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Argininosuccinate synthase (argG)
MBS1019552-02 0.02 mg (Yeast)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Argininosuccinate synthase (argG)

Ask
View Details