Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 4-1BB/TNFRSF9/CD137 (C-6His)

Source: Human Cells. MW :18.1kD. Recombinant Human 4-1BB ligand receptor is produced by our Mammalian expression system and the target gene encoding Leu24-Gln186 is expressed with a 6His tag at the C-terminus. Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL) .

Product Specifications

Gene Name

TNFRSF9

Gene ID

3604

UniProt

Q07011

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Abutilon mosaic virus (isolate West India)(AbMV) AC1 Polyclonal Antibody
MBS7152668 Inquire

Rabbit anti-Abutilon mosaic virus (isolate West India)(AbMV) AC1 Polyclonal Antibody

Ask
View Details
PRIC285 Polyclonal Antibody
UB-GEN-1916 100 µL

PRIC285 Polyclonal Antibody

Ask
View Details
Plant Alpha-Hemoglobin Stabilizing Protein (AHSP) ELISA Kit
MBS9370944 Inquire

Plant Alpha-Hemoglobin Stabilizing Protein (AHSP) ELISA Kit

Ask
View Details
MRTO4
MBS8563260-01 0.2 mL

MRTO4

Ask
View Details
MRTO4
MBS8563260-02 0.1 mL (AF405L)

MRTO4

Ask
View Details
MRTO4
MBS8563260-03 0.1 mL (AF405S)

MRTO4

Ask
View Details