Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 (C-6His)

Source: Human Cells. MW :14.2kD. Recombinant Cynomolgus monkey TIGIT is produced by our Mammalian expression system and the target gene encoding Met89-Pro209 is expressed with a 6His tag at the C-terminus. T cell immunoreceptor with Ig and ITIM domains (TIGIT), also called VSIG9 and Vstm3, is a member of the CD28 family within the Ig superfamily of proteins. TIGIT contains an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM), and is expressed on regulatory, memory, activated T cells and NK cells. TIGIT binds to CD155 (PVR) that appear on dendritic cells (DC), macrophages and endothelium with high affinity, and CD112 (PVRL2) with lower affinity, but not CD113 (PVRL3) . TIGIT-Fc fusion protein could interact with PVR on DC and enhance the secretion of IL-10, but inhibit the macrophage activation. Mice lacking TIGIT show increased T cell responses and susceptibility to autoimmune challenges, while knockdown of TIGIT with siRNA in human memory T cells did not affect T cell responses.

Product Specifications

Gene Name

EGM_10359

UniProt

G7NXM4

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KIAA1310 Rabbit pAb
E47R16997 100 µL

KIAA1310 Rabbit pAb

Ask
View Details
LRRC20 (NM_018239) Human Untagged Clone
SC308865 10 µg

LRRC20 (NM_018239) Human Untagged Clone

Ask
View Details
QM Polyclonal Antibody
JOT-AP07525-01 50ul

QM Polyclonal Antibody

Ask
View Details
QM Polyclonal Antibody
JOT-AP07525-02 100ul

QM Polyclonal Antibody

Ask
View Details
rno-miR-770-3p miRNA Agomir
MBS8315727-01 5 nmol

rno-miR-770-3p miRNA Agomir

Ask
View Details
rno-miR-770-3p miRNA Agomir
MBS8315727-02 10 nmol

rno-miR-770-3p miRNA Agomir

Ask
View Details