Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 (C-6His)

Source: Human Cells. MW :14.2kD. Recombinant Cynomolgus monkey TIGIT is produced by our Mammalian expression system and the target gene encoding Met89-Pro209 is expressed with a 6His tag at the C-terminus. T cell immunoreceptor with Ig and ITIM domains (TIGIT), also called VSIG9 and Vstm3, is a member of the CD28 family within the Ig superfamily of proteins. TIGIT contains an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM), and is expressed on regulatory, memory, activated T cells and NK cells. TIGIT binds to CD155 (PVR) that appear on dendritic cells (DC), macrophages and endothelium with high affinity, and CD112 (PVRL2) with lower affinity, but not CD113 (PVRL3) . TIGIT-Fc fusion protein could interact with PVR on DC and enhance the secretion of IL-10, but inhibit the macrophage activation. Mice lacking TIGIT show increased T cell responses and susceptibility to autoimmune challenges, while knockdown of TIGIT with siRNA in human memory T cells did not affect T cell responses.

Product Specifications

Gene Name

EGM_10359

UniProt

G7NXM4

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA1A (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A) (FITC)
MBS6421615-01 0.1 mL

HSPA1A (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A) (FITC)

Sign In for Pricing
View Details
HSPA1A (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A) (FITC)
MBS6421615-02 5x 0.1 mL

HSPA1A (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal PDE1B Antibody
NBP1-80934 0.1 mL

Rabbit Polyclonal PDE1B Antibody

Sign In for Pricing
View Details
Rat Otp Pre-designed siRNA Set A
SI209919A 1 Each

Rat Otp Pre-designed siRNA Set A

Sign In for Pricing
View Details
0.1N Sulphuric Acid 1L
2053 1 Each

0.1N Sulphuric Acid 1L

Sign In for Pricing
View Details
Human PSME1 (NM_006263) AAV Particle
RC201260A1V 250 µL

Human PSME1 (NM_006263) AAV Particle

Sign In for Pricing
View Details