Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TNF-Like 1/TL1A/TNFSF15

Source: E.coli. MW :20kD. Recombinant Mouse TNF-like 1 is produced by our E.coli expression system and the target gene encoding Ile76-Leu252 is expressed. Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) is a new member of the tumor necrosis factor family. TNFSF15 is predominantly an endothelial cell-specific gene, and recombinant TNFSF15 is a potent inhibitor of endothelial cell proliferation, angiogenesis and tumor growth. TNFSF15 exerts two activities on endothelial cells: early G1 arrest of G0/G1-cells responding to growth stimuli and programmed cell death of proliferating cells. These activities are highly specific to endothelial cells. TNFSF15 is also able to regulate the expression of several important genes involved in angiogenesis. These findings are consistent with the view that TNFSF15 functions as an autocrine cytokine to inhibit angiogenesis and stabilize the vasculature.

Product Specifications

Gene Name

Tnfsf15

Gene ID

326623

UniProt

Q5UBV8

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITMVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGATFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TLR4 Plasmid
PVT7122 2 µg

TLR4 Plasmid

Ask
View Details
Iduronate 2 suLfatase (IDS) (NM_000202) Human Recombinant Protein
TP319187L 1 mg

Iduronate 2 suLfatase (IDS) (NM_000202) Human Recombinant Protein

Ask
View Details
Human NT5C1B shRNA Plasmid
abx964181-01 150 µg

Human NT5C1B shRNA Plasmid

Ask
View Details
Human NT5C1B shRNA Plasmid
abx964181-02 300 µg

Human NT5C1B shRNA Plasmid

Ask
View Details
Bovine Neuregulin 1 isoform HRG-beta 1 (NRG1) ELISA Kit
NSL1217Bo 96 Tests

Bovine Neuregulin 1 isoform HRG-beta 1 (NRG1) ELISA Kit

Ask
View Details