Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mannose Binding Lectin 2/MBL-2/MBP-C

Source: Human Cells. MW :24kD. Recombinant Mouse Mannose Binding Lectin 2 is produced by our Mammalian expression system and the target gene encoding Glu19-Asp244 is expressed. Mannose-binding Lectin (MBL) is an acute phase protein bearing to the family of collectins produced by the liver as a monomer that forms a triple helix. Once released in serum, it further polymerizes forming dimers to octamers. The degree of serum polymerization is critical for the biological activity of MBL. MBL has higher affinity to microbial polysaccharides or their glycoconjugates. MBL was shown earlier to bind cell surfaces of bacteria, fungi, protozoa and viruses and acts as an acute-phase plasma protein (APP) during infection and inflammation. MBL activates the lectin-complement pathway, promotes opsonophagocytosis and modulates inflammation.

Product Specifications

Gene Name

Mbl2

Gene ID

17195

UniProt

Q3UEK1

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse Toll Interacting Protein (TOLLIP)
RPU44063-01 50 µg

Recombinant Mouse Toll Interacting Protein (TOLLIP)

Ask
View Details
Recombinant Mouse Toll Interacting Protein (TOLLIP)
RPU44063-02 100 µg

Recombinant Mouse Toll Interacting Protein (TOLLIP)

Ask
View Details
Recombinant Mouse Toll Interacting Protein (TOLLIP)
RPU44063-03 1 mg

Recombinant Mouse Toll Interacting Protein (TOLLIP)

Ask
View Details
DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTN
MBS6376569-01 0.1 mL

DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTN

Ask
View Details
DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTN
MBS6376569-02 5x 0.1 mL

DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTN

Ask
View Details
RPS27P21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
42385111 3x 1.0 µg

RPS27P21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Ask
View Details