Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mannose Binding Lectin 2/MBL-2/MBP-C

Source: Human Cells. MW :24kD. Recombinant Mouse Mannose Binding Lectin 2 is produced by our Mammalian expression system and the target gene encoding Glu19-Asp244 is expressed. Mannose-binding Lectin (MBL) is an acute phase protein bearing to the family of collectins produced by the liver as a monomer that forms a triple helix. Once released in serum, it further polymerizes forming dimers to octamers. The degree of serum polymerization is critical for the biological activity of MBL. MBL has higher affinity to microbial polysaccharides or their glycoconjugates. MBL was shown earlier to bind cell surfaces of bacteria, fungi, protozoa and viruses and acts as an acute-phase plasma protein (APP) during infection and inflammation. MBL activates the lectin-complement pathway, promotes opsonophagocytosis and modulates inflammation.

Product Specifications

Gene Name

Mbl2

Gene ID

17195

UniProt

Q3UEK1

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AAV6 VP3, Recombinant Protein
VP3-A5146-20ug 20 µg

AAV6 VP3, Recombinant Protein

Ask
View Details
CD Markers CD 8a
143-44 100 μg

CD Markers CD 8a

Ask
View Details
Rabbit Polyclonal GCSH Antibody
NBP3-00326-50ul 50 µL

Rabbit Polyclonal GCSH Antibody

Ask
View Details
Rabbit Polyclonal LRRK2 Antibody [mFluor Violet 500 SE]
NB110-58771MFV500 0.1 mL

Rabbit Polyclonal LRRK2 Antibody [mFluor Violet 500 SE]

Ask
View Details
IL9R Protein (C-Human Fc Tag, )
P511668 100 µg

IL9R Protein (C-Human Fc Tag, )

Ask
View Details
Rabbit Polyclonal DHX15 Antibody [DyLight 755]
NBP2-97611IR 0.1 mL

Rabbit Polyclonal DHX15 Antibody [DyLight 755]

Ask
View Details