Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 7/FGF-7/KGF (C-6His)

Source: Human Cells. MW :20kD. Recombinant Human Fibroblast Growth Factor 7 is produced by our Mammalian expression system and the target gene encoding Cys32-Thr194 is expressed with a 6His tag at the C-terminus. Fibroblast growth factor 7 (FGF7) is a secreted protein which is mainly located in epithelial cells and belongs to the heparin-binding growth factors family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. It is possible major paracrine effector of normal epithelial cell proliferation.

Product Specifications

Gene Name

FGF7

Gene ID

2252

UniProt

P21781

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAITVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Laniquidar TFA
MBS5806794 Inquire

Laniquidar TFA

Ask
View Details
ING5 siRNA (Human)
MBS8238102-01 15 nmol

ING5 siRNA (Human)

Ask
View Details
ING5 siRNA (Human)
MBS8238102-02 30 nmol

ING5 siRNA (Human)

Ask
View Details
ING5 siRNA (Human)
MBS8238102-03 5x 30 nmol

ING5 siRNA (Human)

Ask
View Details
ACSF2 Antibody, FITC conjugated
A65372-100UG 100 µg

ACSF2 Antibody, FITC conjugated

Ask
View Details
JAK2 Antibody
A26080-100UG 100 µg

JAK2 Antibody

Ask
View Details