Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Decorin/PGS2/PG40 (C-6His)

Source: Human Cells. MW :39kD. Recombinant Mouse Decorin is produced by our Mammalian expression system and the target gene encoding Gly17-Lys354 is expressed with a 6His tag at the C-terminus. Decorin, also known as PG40 and DCN, is a member of the class I family of small leucine-rich proteoglycans (SLRPs) that is expressed in the stroma of various forms of cancer and has been recently proposed to act as a guardian from the matrix. Mature human Decorin contains 12 tandem LRR and shares 80% and 78% aa sequence identity with mouse and rat Decorin, respectively. Decorin embraces numerous functions including: regulation of collagen fibrillogenesis, hepatic carcinogenesis, fetal membrane and calcium homeostasis, keratinocyte function, and suppression of angiogenesis. Most recently, soluble decorin has been shown to induce autophagy in endothelial cells and mitophagy in breast carcinoma cells.

Product Specifications

Gene Name

Dcn

Gene ID

13179

UniProt

P28654

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYKVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAX1BP1 Polyclonal Antibody, Biotin Conjugated
A68994-100 100 µL

TAX1BP1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Glycyl-l-isoleucine
HY-W216585 100 mg

Glycyl-l-isoleucine

Sign In for Pricing
View Details
Phospho-CD244 (Tyr271) Rabbit Polyclonal Antibody (Cy5)
orb895843 100 µL

Phospho-CD244 (Tyr271) Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
KIAA0317 antibody
70R-6284 100 µL

KIAA0317 antibody

Sign In for Pricing
View Details
TSLP, CT (TSLP, Thymic stromal lymphopoietin) (PE) discontinued
043368-PE 200 µL

TSLP, CT (TSLP, Thymic stromal lymphopoietin) (PE) discontinued

Sign In for Pricing
View Details
Human neuroligin-1 (NLGN1) ELISA Kit
YP-W19367-01 48 Tests

Human neuroligin-1 (NLGN1) ELISA Kit

Sign In for Pricing
View Details