Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Decorin/PGS2/PG40 (C-6His)

Source: Human Cells. MW :39kD. Recombinant Mouse Decorin is produced by our Mammalian expression system and the target gene encoding Gly17-Lys354 is expressed with a 6His tag at the C-terminus. Decorin, also known as PG40 and DCN, is a member of the class I family of small leucine-rich proteoglycans (SLRPs) that is expressed in the stroma of various forms of cancer and has been recently proposed to act as a guardian from the matrix. Mature human Decorin contains 12 tandem LRR and shares 80% and 78% aa sequence identity with mouse and rat Decorin, respectively. Decorin embraces numerous functions including: regulation of collagen fibrillogenesis, hepatic carcinogenesis, fetal membrane and calcium homeostasis, keratinocyte function, and suppression of angiogenesis. Most recently, soluble decorin has been shown to induce autophagy in endothelial cells and mitophagy in breast carcinoma cells.

Product Specifications

Gene Name

Dcn

Gene ID

13179

UniProt

P28654

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYKVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Guinea pig Thiobarbituric Acid Reactive Substances (TBARS) ELISA Kit
EIA06995Gu 1 Kit

Guinea pig Thiobarbituric Acid Reactive Substances (TBARS) ELISA Kit

Ask
View Details
MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (HRP)
MBS6384591-01 0.1 mL

MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (HRP)

Ask
View Details
MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (HRP)
MBS6384591-02 5x 0.1 mL

MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (HRP)

Ask
View Details
Mouse Adpgk qPCR Primer Pair
QM40882S 200 Tests

Mouse Adpgk qPCR Primer Pair

Ask
View Details
pLV3-U6-Gys1-shRNA2-CopGFP-Puro Plasmid
PVT49033 2 µg

pLV3-U6-Gys1-shRNA2-CopGFP-Puro Plasmid

Ask
View Details