Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LIGHT/HVEM-L/TNFSF14/CD258 (N-6His)

Source: Human Cells. MW :18.2kD. Recombinant Human LIGHT is produced by our Mammalian expression system and the target gene encoding Leu83-Val240 is expressed with a 6His tag at the N-terminus. Human TNFSF14 Protein, also known as LIGHT, belongs to a member of the tumor necrosis factor (TNF) ligand family. It can bind to NFRSF3/LTBR. It is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and it is also known as a herpesvirus entry mediator ligand (HVEML) . TNFSF14 encodes a protein with a 37 aa cytoplasmic domain, 21aa transmembrane domain and 182 aa extracellular region. The gene is predominantly expressed in the spleen and also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tumor lines. TNFSF14 protein was found to probably function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. Studies have shown that this protein can prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported.

Product Specifications

Gene Name

TNFSF14

Gene ID

8740

UniProt

O43557

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHGLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EGFR antibody
MBS534008-01 0.25 mg

EGFR antibody

Ask
View Details
EGFR antibody
MBS534008-02 5x 0.25 mg

EGFR antibody

Ask
View Details
TYK2 Polyclonal Antibody, RBITC Conjugated
bs-6662R-RBITC-01 20 µL

TYK2 Polyclonal Antibody, RBITC Conjugated

Ask
View Details
TYK2 Polyclonal Antibody, RBITC Conjugated
bs-6662R-RBITC-02 100 µL

TYK2 Polyclonal Antibody, RBITC Conjugated

Ask
View Details
Protein inhibitor of activated STAT 1 (PIAS1) [N-terminus]  polyclonal antibody
ABP-PAB-10342 100 ug

Protein inhibitor of activated STAT 1 (PIAS1) [N-terminus] polyclonal antibody

Ask
View Details
Human Luteinizing Hormone-Releasing Hormone, LHRH ELISA Kit
MBS161127-01 48 Well

Human Luteinizing Hormone-Releasing Hormone, LHRH ELISA Kit

Ask
View Details