Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B7-H3/CD276 (C-6His)

Source: Human Cells. MW :24.3kD. Recombinant Mouse B7 Homolog 3 is produced by our Mammalian expression system and the target gene encoding Val29-Phe244 is expressed with a 6His tag at the C-terminus. CD276, also known as B7-H3, is a member of the B7 superfamily with signature IgV and IgG regions in extracellular domains. It is a type I transmembrane protein and shares 20–27% amino acid identity with other B7 family members. B7-H3 is involved in the activation of T lymphocytes, and regulates murine bone formation. It is also reported that B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is expressed on T-cells, natural killer cells, and antigen presenting cells, as well as some non-immune cells, such as osteoblasts, fibroblasts, fibroblast-like synoviocytes and epithelial cells. High expression of B7-H3 in tumor vasculature also correlates with poor survival in patients, suggesting that it may play a role in tumor cell migration.

Product Specifications

Gene Name

Cd276

Gene ID

102657

UniProt

Q8VE98

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNN1 Human qPCR Primer Pair (NM_002248)
HP205978 200 Reactions

KCNN1 Human qPCR Primer Pair (NM_002248)

Sign In for Pricing
View Details
[KO Validated] DNA Ligase IV Rabbit pAb
E45R24179N-50 50 µL

[KO Validated] DNA Ligase IV Rabbit pAb

Sign In for Pricing
View Details
2,3-Dihydro-1H-isoindole-4-carboxylic Acid
419744 5 mg

2,3-Dihydro-1H-isoindole-4-carboxylic Acid

Sign In for Pricing
View Details
Rbpj (NM_001106631) Rat Tagged Lenti ORF Clone
RR215087L4 10 µg

Rbpj (NM_001106631) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bovine Transmembrane protein 68 (TMEM68) ELISA Kit
GTR10320592 96 Well

Bovine Transmembrane protein 68 (TMEM68) ELISA Kit

Sign In for Pricing
View Details
Pantoic acid sodium
TYD-04551-01 10 mg

Pantoic acid sodium

Sign In for Pricing
View Details