Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B7-H3/CD276 (C-6His)

Source: Human Cells. MW :24.3kD. Recombinant Mouse B7 Homolog 3 is produced by our Mammalian expression system and the target gene encoding Val29-Phe244 is expressed with a 6His tag at the C-terminus. CD276, also known as B7-H3, is a member of the B7 superfamily with signature IgV and IgG regions in extracellular domains. It is a type I transmembrane protein and shares 20–27% amino acid identity with other B7 family members. B7-H3 is involved in the activation of T lymphocytes, and regulates murine bone formation. It is also reported that B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is expressed on T-cells, natural killer cells, and antigen presenting cells, as well as some non-immune cells, such as osteoblasts, fibroblasts, fibroblast-like synoviocytes and epithelial cells. High expression of B7-H3 in tumor vasculature also correlates with poor survival in patients, suggesting that it may play a role in tumor cell migration.

Product Specifications

Gene Name

Cd276

Gene ID

102657

UniProt

Q8VE98

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLR1 Antibody
orb1471696-01 10 µg

FOLR1 Antibody

Sign In for Pricing
View Details
FOLR1 Antibody
orb1471696-02 50 µg

FOLR1 Antibody

Sign In for Pricing
View Details
FOLR1 Antibody
orb1471696-03 100 µg

FOLR1 Antibody

Sign In for Pricing
View Details
FOLR1 Antibody
orb1471696-04 500 µg

FOLR1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MRPS26 Antibody [Alexa Fluor 647]
NBP2-97474AF647 0.1 mL

Rabbit Polyclonal MRPS26 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
CD40L (human) ELISA Kit
K4783-100 100 assays

CD40L (human) ELISA Kit

Sign In for Pricing
View Details