Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PDCD1/PD-1/CD279 (C93S Mutant, C-6His)

Source: Human Cells. MW :43.1kD. Recombinant Human Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Leu25-Gln167 is expressed with a Fc tag at the C-terminus. Programmed cell death protein 1 (PDCD1) is a single-pass type I membrane protein and contains 1 Ig-like V-type domain. PD-1 is a member of the extended CD28/CTLA-4 family of T cell regulators. PDCD1 inhibits the T-cell proliferation and production of related cytokines including IL-1, IL-4, IL-10 and IFN- gamma by suppressing the activation and transduction of PI3K/AKT pathway. In addition, coligation of PDCD1 inhibits BCR-mediating signal by dephosphorylating key signal transducer. PDCD1 has been suggested to be involved in lymphocyte clonal selection and peripheral tolerance, and thus contributes to the prevention of autoimmune diseases. As a cell surface molecule, PDCD1 regulates the adaptive immune response. Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function.

Product Specifications

Gene Name

PDCD1

Gene ID

5133

UniProt

Q15116

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Metallothionein (MT1A) Human siRNA Oligo Duplex (Locus ID 4489)
SR302979 1 Kit

Metallothionein (MT1A) Human siRNA Oligo Duplex (Locus ID 4489)

Ask
View Details
Phosphorylase Kinase Subunit gamma 2, NT (PHKG2, Phosphorylase B Kinase gamma Catalytic Chain Testis/liver Isoform, PHK-gamma-T, GSD9C, PSK-C3) (MaxLight 405) discontinued
P4075-85N-ML405 100 µL

Phosphorylase Kinase Subunit gamma 2, NT (PHKG2, Phosphorylase B Kinase gamma Catalytic Chain Testis/liver Isoform, PHK-gamma-T, GSD9C, PSK-C3) (MaxLight 405) discontinued

Ask
View Details
BCOR, ID (S1122) (BCL-6 Corepressor, BCoR, KIAA1575) (MaxLight 405) discontinued
B0808-03A-ML405 100 µL

BCOR, ID (S1122) (BCL-6 Corepressor, BCoR, KIAA1575) (MaxLight 405) discontinued

Ask
View Details
2ml Clear vial, 10-425 screw top, graduated with writing area
SV023C2 100 PCS/PK

2ml Clear vial, 10-425 screw top, graduated with writing area

Ask
View Details
Mouse soluble interleukin-2 receptor, sIL-2Ralpha ELISA Kit
MBS704367-01 24 Well (LIMIT 1)

Mouse soluble interleukin-2 receptor, sIL-2Ralpha ELISA Kit

Ask
View Details
Mouse soluble interleukin-2 receptor, sIL-2Ralpha ELISA Kit
MBS704367-02 48 Well

Mouse soluble interleukin-2 receptor, sIL-2Ralpha ELISA Kit

Ask
View Details