Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Tryptophan Synthase (N-6His)

Source: E. coli. MW :72.5kD. Recombinant E.coli Tryptophan synthase is produced by our E.coli expression system and the target gene encoding Met1-Ser268&Thr2-Ile397 is expressed with a 6His tag at the N-terminus. Tryptophan synthase is a multienzyme a2 beta2 complex composed of two protein subunit. Tryptophan synthase catalyzes the last two steps in the synthesis of L-tryptophan (L-Trp) . The a-subunit catalyzes cleavage of 3-indole-d-glycerol 3'-phosphate (IGP) to give indole and D-glyceraldehyde 3'-phosphate (G3P) . Indole is then transferred through a 25-Ã… hydrophobic tunnel to the beta-subunit. The beta2 subunit contains pyridoxal 5'-phosphate and catalyzes several pyridoxal 5'-phosphate-dependent reactions, including/3-elimination reactions 6 and a thiol-dependent transamination reaction. This enzyme is commonly found in Eubacteria, Archaebacteria, Protista, Fungi, and Plantae, but is absent from Animalia. As humans do not have tryptophan synthase, this enzyme has been explored as a potential drug target.

Product Specifications

Gene Name

TrpA

Gene ID

946204

UniProt

P0A877

Components

Supplied as a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS&MHHHHHHTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALTKCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGMFADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQLLVVNLSGRGDKDIFTVHDILKARGEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rho GTPase activating protein 24 (ARHGAP24) (NM_001042669) Human Over-expression Lysate
LC421018 20 µg

Rho GTPase activating protein 24 (ARHGAP24) (NM_001042669) Human Over-expression Lysate

Sign In for Pricing
View Details
Oct6 (POU3F1) Rabbit Polyclonal Antibody
AP20431PU-N 100 µg

Oct6 (POU3F1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 pSer10 Rabbit Polyclonal Antibody
AP12545PU-N 400 µL

Histone H3 pSer10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Adra1a activation kit by CRISPRa
GA200099 1 Kit

Mouse Adra1a activation kit by CRISPRa

Sign In for Pricing
View Details
Human GI24 (C10orf54) activation kit by CRISPRa
GA111984 1 Kit

Human GI24 (C10orf54) activation kit by CRISPRa

Sign In for Pricing
View Details
PCOLCE (NM_002593) Human Over-expression Lysate
LC419210 20 µg

PCOLCE (NM_002593) Human Over-expression Lysate

Sign In for Pricing
View Details