Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Tryptophan Synthase (N-6His)

Source: E. coli. MW :72.5kD. Recombinant E.coli Tryptophan synthase is produced by our E.coli expression system and the target gene encoding Met1-Ser268&Thr2-Ile397 is expressed with a 6His tag at the N-terminus. Tryptophan synthase is a multienzyme a2 beta2 complex composed of two protein subunit. Tryptophan synthase catalyzes the last two steps in the synthesis of L-tryptophan (L-Trp) . The a-subunit catalyzes cleavage of 3-indole-d-glycerol 3'-phosphate (IGP) to give indole and D-glyceraldehyde 3'-phosphate (G3P) . Indole is then transferred through a 25-Ã… hydrophobic tunnel to the beta-subunit. The beta2 subunit contains pyridoxal 5'-phosphate and catalyzes several pyridoxal 5'-phosphate-dependent reactions, including/3-elimination reactions 6 and a thiol-dependent transamination reaction. This enzyme is commonly found in Eubacteria, Archaebacteria, Protista, Fungi, and Plantae, but is absent from Animalia. As humans do not have tryptophan synthase, this enzyme has been explored as a potential drug target.

Product Specifications

Gene Name

TrpA

Gene ID

946204

UniProt

P0A877

Components

Supplied as a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS&MHHHHHHTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALTKCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGMFADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQLLVVNLSGRGDKDIFTVHDILKARGEI
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Dried Blood Spot DNA Isolation Kit
36000 50 Preparations

Dried Blood Spot DNA Isolation Kit

Ask
View Details
Phospho-NMDAR2B  (Ser1284)  Antibody
ABF3676 100 µg

Phospho-NMDAR2B (Ser1284) Antibody

Ask
View Details
Rabbit Polyclonal TEKT2 Antibody
NBP1-86955-25ul 25 µL

Rabbit Polyclonal TEKT2 Antibody

Ask
View Details
RAD23A (UV Excision Repair Protein RAD23 Homolog A, HR23A, hHR23A, MGC111083) (Biotin)
138279-Biotin 100 µL

RAD23A (UV Excision Repair Protein RAD23 Homolog A, HR23A, hHR23A, MGC111083) (Biotin)

Ask
View Details
Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin Alpha, Sargramostim) (Biotin)
G8951-10G-Biotin 100 µL

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin Alpha, Sargramostim) (Biotin)

Ask
View Details