Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse OX40 Ligand/TNFSF4/OX40L (N-8His)

Source: Human Cells. MW :17.7kD. Recombinant Mouse OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Ser51-Leu198 is expressed with a 8His tag at the N-terminus. OX40 ligand (OX40L), also called CD252, is a single-pass type II membrane protein of the TNF/TNF receptor superfamily. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40 which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells. OX40L–OX40 co-stimulation leads to activation of TNF receptor associated factor (TRAF) 2, 3 and 5. This pathway has been shown to prolong the survival of effector CD4+Th cells as well as contributes to generation of memory T cells.

Product Specifications

Gene Name

Tnfsf4

Gene ID

22164

UniProt

P43488

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RDH10 Antibody (Center) Blocking Peptide
MBS9225347-01 0.5 mg

RDH10 Antibody (Center) Blocking Peptide

Ask
View Details
RDH10 Antibody (Center) Blocking Peptide
MBS9225347-02 5x 0.5 mg

RDH10 Antibody (Center) Blocking Peptide

Ask
View Details
Anti-Rabbit IgG (H+L) - 100nm Gold Conjugate
AC-100-01 1 mL

Anti-Rabbit IgG (H+L) - 100nm Gold Conjugate

Ask
View Details
Mphosph6 (NM_001129881) Rat Tagged ORF Clone Lentiviral Particle
RR205872L4V 200 µL

Mphosph6 (NM_001129881) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
PFKM protein (His tag)
80R-1301 100 ug

PFKM protein (His tag)

Ask
View Details
ADNP (ADNP1, KIAA0784, Activity-dependent neuroprotector homeobox protein, Activity-dependent neuroprotective protein)
305013-01 50 µg

ADNP (ADNP1, KIAA0784, Activity-dependent neuroprotector homeobox protein, Activity-dependent neuroprotective protein)

Ask
View Details