Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-22/IL-22 (C-hIgG4 Fc)

Source: Human Cells. MW :43.4kD. Recombinant Human Interleukin-22 is produced by our Mammalian expression system and the target gene encoding Ala34-Ile179 is expressed with a hIgG4 Fc tag at the C-terminus. Interleukin-22 (IL-22) is a member of a group of the IL-10 family, a class of potent mediators of cellular inflammatory responses. IL-22 is produced by activated DC and T cells. IL-22 and IL-10 receptor chains play a role in cellular targeting and signal transduction. It can initiate and regulate innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 likely plays a role in the coordinated response of both adaptive and innate immune systems. IL-22 also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. Biological activity of IL-22 is initiated by binding to a cell-surface complex consisting of IL-22R1 and IL-10R2 receptor chains. IL-22 biological activity is further regulated by interactions with a soluble binding protein, IL-22BP. IL-22BP and an extracellular region of IL-22R1 share sequence similarity. In some cases, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by cytokine IL-17A.

Product Specifications

Gene Name

IL22

Gene ID

50616

UniProt

Q9GZX6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIGGGGSGGGGSGGGGSAESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SPTLC2 Protein Vector (Mouse) (pPM-C-HA)
45426024 500 ng

SPTLC2 Protein Vector (Mouse) (pPM-C-HA)

Ask
View Details
A-Catenin (AP) discontinued
C2069-44-AP 100 µL

A-Catenin (AP) discontinued

Ask
View Details
CCDC97 (h) -PR
sc-97307-PR 10 µM - 20 µL

CCDC97 (h) -PR

Ask
View Details
2-acylglycerol O-acyltransferase 3 (MOGAT3) Human ELISA Kit
B0284 96 Tests

2-acylglycerol O-acyltransferase 3 (MOGAT3) Human ELISA Kit

Ask
View Details
3,4-Dimethoxy-α-[3- (methylamino) propyl]-α- (1-methylethyl) -benzeneacetonitrile Hydrochloride
160769 10 mg

3,4-Dimethoxy-α-[3- (methylamino) propyl]-α- (1-methylethyl) -benzeneacetonitrile Hydrochloride

Ask
View Details