Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His)

Source: E.coli. MW :31.3kD. Recombinant Dechloromonas aromatica (strain RCB) Chlorite dismutase Chlorite dismutase is produced by our E.coli expression system and the target gene encoding Met35-Asp282 is expressed with a 6His tag at the N-terminus. Chlorite dismutase (Cld) found in prokaryotic organisms, also known as Chlorite O2-lyase, is a b-type heme containing enzyme that catalyzes the reduction of chlorite into chloride plus dioxygen. The subunit of chlorite dismutase consists of a heme free N-terminal and a heme b containing C-terminal ferredoxin-like fold with high structural homology to the dye-decolorizing peroxidases (DyPs) . The physiological role of Cld in prokaryote has been shown that some microorganisms can use perchlorate or chlorate as terminal electron acceptors for anaerobic respiration thereby producing chlorite that must be detoxified. This enzyme has gained attention because it can be used in the development of bioremediation processes, biosensors, and controlled dioxygen production.

Product Specifications

Gene Name

Daro_2580

UniProt

Q47CX0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, 0.5mM EDTA, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMENLYFQGMQPMQSMKIERGTILTQPGVFGVFTMFKLRPDWNKVPVAERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTVGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Phosphatidylinositol 4-Kinase Type 2-Alpha (PI4K2A) ELISA Kit
MBS9922158 Inquire

Goat Phosphatidylinositol 4-Kinase Type 2-Alpha (PI4K2A) ELISA Kit

Ask
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (PE)
246758-PE 100 µL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (PE)

Ask
View Details
Human APOL3 (NM_145641) AAV Particle
RC212625A1V 250 µL

Human APOL3 (NM_145641) AAV Particle

Ask
View Details
Human PD-L1/B7-H1 MAb (Clone 130021R)
MAB1561R-100 100 µg

Human PD-L1/B7-H1 MAb (Clone 130021R)

Ask
View Details
RASSF6 CRISPR All-in-one AAV vector set (with saCas9)(Human)
38558151 3x 1.0 µg DNA

RASSF6 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
6-Arm-PEG-DA (MW 5000)
MF-0060026-01 10 mg

6-Arm-PEG-DA (MW 5000)

Ask
View Details