Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marmoset T Cell Ig and Mucin Domain-3/TIM3/HAVCR2 (C-6His)

Source: Human Cells. MW :19.7kD. Recombinant Marmoset TIM-3 is produced by our Mammalian expression system and the target gene encoding Glu24-Ile193 is expressed with a 6His tag at the C-terminus. T cell immunoglobulin and mucin domain-3 (TIM3), also called hepatitis A virus cellular receptor 2 (HAVCR2), is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response. TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3 expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement of TIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotes inflammation through the activation of innate immune cells. TIM3 is also regarded as a potential target molecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitory regulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated with chronic HBV infection including HBV-related HCC.

Product Specifications

Gene Name

HAVCR2

UniProt

F7I881

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EEYIVEVGQNAYLPCFYTLDTPGNLVPVCWGKGACPVFECGDVVLRTDERDVSYRTSSRYWLNGDFHKGNVTLAIGNVTLEDSGIYCCRVQIPGIMNDKKFNLKLVIKPAKVTPAPTLPRDSTPAFPRMLTTEDHGPAETQTLEILHDKNLTQLSTLANELQDAGTTIRIHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam6b 3'UTR Luciferase Stable Cell Line
TU101380 1.0 mL

Adam6b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SERPINC1 Adenovirus (Mouse)
43497054 1.0 mL

SERPINC1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Human CD83 Protein, His Tag
KMP1399 50 µg

Recombinant Human CD83 Protein, His Tag

Sign In for Pricing
View Details
STOML2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2305704 1.0 µg DNA

STOML2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Gm13119 (NM_001034101) Mouse Untagged Clone
MC216756 10 µg

Gm13119 (NM_001034101) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Baculoviral IAP Repeat Containing Protein 2 (BIRC2)
SIPE410Hu01-01 10 µg

Recombinant Baculoviral IAP Repeat Containing Protein 2 (BIRC2)

Sign In for Pricing
View Details