Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marmoset T Cell Ig and Mucin Domain-3/TIM3/HAVCR2 (C-6His)

Source: Human Cells. MW :19.7kD. Recombinant Marmoset TIM-3 is produced by our Mammalian expression system and the target gene encoding Glu24-Ile193 is expressed with a 6His tag at the C-terminus. T cell immunoglobulin and mucin domain-3 (TIM3), also called hepatitis A virus cellular receptor 2 (HAVCR2), is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response. TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3 expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement of TIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotes inflammation through the activation of innate immune cells. TIM3 is also regarded as a potential target molecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitory regulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated with chronic HBV infection including HBV-related HCC.

Product Specifications

Gene Name

HAVCR2

UniProt

F7I881

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EEYIVEVGQNAYLPCFYTLDTPGNLVPVCWGKGACPVFECGDVVLRTDERDVSYRTSSRYWLNGDFHKGNVTLAIGNVTLEDSGIYCCRVQIPGIMNDKKFNLKLVIKPAKVTPAPTLPRDSTPAFPRMLTTEDHGPAETQTLEILHDKNLTQLSTLANELQDAGTTIRIHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Leukotriene D4 (LTD4) ELISA Kit
YP-W20159-01 48 Tests

Mouse Leukotriene D4 (LTD4) ELISA Kit

Sign In for Pricing
View Details
Mouse Leukotriene D4 (LTD4) ELISA Kit
YP-W20159-02 96 Tests

Mouse Leukotriene D4 (LTD4) ELISA Kit

Sign In for Pricing
View Details
2-[(1,3-Dihydro-1,3-dioxo-2H-isoindol-2-yl)acetyl]-butanedioic Acid Diethyl Ester
TRC-D449108-5MG 5 mg

2-[(1,3-Dihydro-1,3-dioxo-2H-isoindol-2-yl)acetyl]-butanedioic Acid Diethyl Ester

Sign In for Pricing
View Details
GRP78 Blocking Peptide
CBP1553-01 1 mg

GRP78 Blocking Peptide

Sign In for Pricing
View Details
GRP78 Blocking Peptide
CBP1553-02 5 mg

GRP78 Blocking Peptide

Sign In for Pricing
View Details
TCFAP2C antibody
MBS835727-01 0.1 mL

TCFAP2C antibody

Sign In for Pricing
View Details