Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IAP/OA3/CD47 (C-Fc)

Source: Human Cells. MW :42.8kD. Recombinant Mouse CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro158 is expressed with a Fc tag at the C-terminus. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Product Specifications

Gene Name

Cd47

Gene ID

16423

UniProt

Q61735

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Copeptin ELISA Kit
MBS3807959-01 48 Well

Rat Copeptin ELISA Kit

Ask
View Details
Rat Copeptin ELISA Kit
MBS3807959-02 96 Well

Rat Copeptin ELISA Kit

Ask
View Details
Rat Copeptin ELISA Kit
MBS3807959-03 5x 96 Well

Rat Copeptin ELISA Kit

Ask
View Details
Rat Copeptin ELISA Kit
MBS3807959-04 10x 96 Well

Rat Copeptin ELISA Kit

Ask
View Details
Anti-PMS2, Antibody
GWB-490FD4 100 µg

Anti-PMS2, Antibody

Ask
View Details
Ginkgolide B
300338 20 mg

Ginkgolide B

Ask
View Details