Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prolactin Receptor/PRLR (C-Fc)

Source: Human Cells. MW :51.7kD. Recombinant Mouse Prolactin receptor is produced by our Mammalian expression system and the target gene encoding Gln20-Asp229 is expressed with a Fc tag at the C-terminus. The prolactin receptor (PRLR) is a member of the class I cytokine/lactogen receptor family which mediates the diverse cellular actions of prolactin in several tissues. PRLRs are expressed in normal and neoplastic human breast tissue, and in most breast cancer cells. PRLR contains an extracellular region that binds prolactin, a transmembrane region, and a cytoplasmatic region required for the activation of the Jak2–Stat5 signal transduction pathway by Prl which is essential for transcriptional activation of all known prolactin regulated genes. PRLRs have also been observed in ovarian follicular cells of mice, pigs, sheep, deer, and humans, as well as in luteal tissue in cow and horse ovaries. Furthermore, PRLR knockout mice exhibit failure of embryonic implantation, reduced number of mature oocytes, and low fertilization rates. Knockout females also display a reduced number of primary follicles.

Product Specifications

Gene Name

Prlr

Gene ID

19116

UniProt

Q08501

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Consortin (CNST) (NM_001139459) Human Tagged ORF Clone Lentiviral Particle
RC227640L3V 200 µL

Consortin (CNST) (NM_001139459) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PGLYRP4 Recombinant Protein (Rat)
RP220226 100 µg

PGLYRP4 Recombinant Protein (Rat)

Sign In for Pricing
View Details
PPIC, ID (PPIC, CYPC, Peptidyl-prolyl cis-trans isomerase C, Cyclophilin C, Rotamase C) (Azide free) (HRP)
MBS6336262-01 0.2 mL

PPIC, ID (PPIC, CYPC, Peptidyl-prolyl cis-trans isomerase C, Cyclophilin C, Rotamase C) (Azide free) (HRP)

Sign In for Pricing
View Details
PPIC, ID (PPIC, CYPC, Peptidyl-prolyl cis-trans isomerase C, Cyclophilin C, Rotamase C) (Azide free) (HRP)
MBS6336262-02 5x 0.2 mL

PPIC, ID (PPIC, CYPC, Peptidyl-prolyl cis-trans isomerase C, Cyclophilin C, Rotamase C) (Azide free) (HRP)

Sign In for Pricing
View Details
LINC00242 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV799489 1.0 µg DNA

LINC00242 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Lentiviral mouse Habp4 shRNA (UAS) - Lentiviral mouseHabp4 shRNA (UAS, GFP) (25)
GTR15193676 1 Vial

Lentiviral mouse Habp4 shRNA (UAS) - Lentiviral mouseHabp4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details