Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 (C-6His)

Source: Human Cells. MW :20.2kD. Recombinant Mouse TIM-3 is produced by our Mammalian expression system and the target gene encoding Arg20-Arg191 is expressed with a 6His tag at the C-terminus. T cell immunoglobulin and mucin domain-3 (TIM3), also called hepatitis A virus cellular receptor 2 (HAVCR2), is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response. TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3 expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement of TIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotes inflammation through the activation of innate immune cells. TIM3 is also regarded as a potential target molecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitory regulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated with chronic HBV infection including HBV-related HCC.

Product Specifications

Gene Name

Havcr2

Gene ID

171285

UniProt

Q8VIM0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal PDE11A Antibody
NBP3-12255 100 µg

Rabbit Polyclonal PDE11A Antibody

Ask
View Details
Recombinant NUDT19 Antibody
RC-4861-01 50 μL

Recombinant NUDT19 Antibody

Ask
View Details
Recombinant NUDT19 Antibody
RC-4861-02 100 µL

Recombinant NUDT19 Antibody

Ask
View Details
Recombinant NUDT19 Antibody
RC-4861-03 1 mL

Recombinant NUDT19 Antibody

Ask
View Details
Rat monoclonal CD45 antibody (FITC)
MBS5305568-01 0.05 mg

Rat monoclonal CD45 antibody (FITC)

Ask
View Details
Rat monoclonal CD45 antibody (FITC)
MBS5305568-02 0.1 mg

Rat monoclonal CD45 antibody (FITC)

Ask
View Details