Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD83/HB15 (C-6His)

Source: Human Cells. MW :17.4kD. Recombinant Mouse CD83 is produced by our Mammalian expression system and the target gene encoding Met22-Ala134 is expressed with a 6His tag at the C-terminus. CD83 antigen is a single-pass type I membrane protein which contains one Ig-like V-type (immunoglobulin-like) domain. CD83 is expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells. It contains one Ig-like V-type (immunoglobulin-like) domain. , the soluble CD83 has the opposite effect and has an immune inhibitory capacity. Due to its immune inhibitory function, CD83 may play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Product Specifications

Gene Name

Cd83

Gene ID

12522

UniProt

O88324

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Biotin (Vitamin B7 or Vitamin H) Antibody (SPM375) [DyLight 350]
NBP2-34771UV 0.1 mL

Mouse Monoclonal Biotin (Vitamin B7 or Vitamin H) Antibody (SPM375) [DyLight 350]

Ask
View Details
ECHS1 Recombinant Protein Antigen
NBP1-87078PEP 0.1 mL

ECHS1 Recombinant Protein Antigen

Ask
View Details
IFNA6 (Interferon alpha-6, IFN-alpha-6, Interferon alpha-54, Interferon alpha-K, LeIF K) (MaxLight 405) discontinued
128290-ML405 100 µL

IFNA6 (Interferon alpha-6, IFN-alpha-6, Interferon alpha-54, Interferon alpha-K, LeIF K) (MaxLight 405) discontinued

Ask
View Details
anti-ketohexokinase
YF-PA12830 100 ul

anti-ketohexokinase

Ask
View Details
Human STH Pre-designed siRNA Set B
SI015919B 1 Each

Human STH Pre-designed siRNA Set B

Ask
View Details
Prr9 (NM_175424) Mouse Tagged ORF Clone Lentiviral Particle
MR216956L4V 200 µL

Prr9 (NM_175424) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details