Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mesothelin/MSLN/CAK1/MPF (C-6His)

Source: Human Cells. MW :27.8kD. Recombinant Human Mesothelin is produced by our Mammalian expression system and the target gene encoding Leu37-Arg286 is expressed with a 6His tag at the C-terminus. Mesothelin is a cell surface glycoprotein whose expression is limited to mesothelial cells of the serosa (pleura, pericardium, and peritoneum) and epithelial cells of the trachea, tonsils, fallopian tube, and kidneys. Mesothelin plays an important role in cell survival, proliferation, migration, invasion, tumor progression, and resistance to chemotherapy. The overexpression of mesothelin can activate NF-kB and signal transducer and activator of transcription 3 (Stat3), inhibit apoptotic signaling and TNF-a-induced apoptosis, and accelerate the G1–S transition. Mesothelin is also found overexpressed in various cancers, including malignant mesothelioma, pancreatic or ovarian carcinoma, sarcomas and in some gastrointestinal or pulmonary carcinomas. As a result of its limited expression in normal tissues, mesothelin has been reported as an ideal tumor-associated marker for the development of targeted therapy.

Product Specifications

Gene Name

MSLN

Gene ID

10232

UniProt

Q13421

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal SARS2 Antibody [Alexa Fluor 488]
NBP2-97631AF488 0.1 mL

Rabbit Polyclonal SARS2 Antibody [Alexa Fluor 488]

Ask
View Details
Human USP17L25 shRNA Plasmid
abx968662-01 150 µg

Human USP17L25 shRNA Plasmid

Ask
View Details
Human USP17L25 shRNA Plasmid
abx968662-02 300 µg

Human USP17L25 shRNA Plasmid

Ask
View Details
RBM22, ID (RBM22, ZC3H16, Pre-mRNA-splicing factor RBM22, RNA-binding motif protein 22, Zinc finger CCCH domain-containing protein 16) (Biotin) discontinued
040887-Biotin 200 µL

RBM22, ID (RBM22, ZC3H16, Pre-mRNA-splicing factor RBM22, RNA-binding motif protein 22, Zinc finger CCCH domain-containing protein 16) (Biotin) discontinued

Ask
View Details
Mouse Anti-Human CD11b-APC
31-3405-25 25 Tests

Mouse Anti-Human CD11b-APC

Ask
View Details
Creatine Kinase M-Type Polyclonal Conjugated Antibody
MBS9450919-01 0.1 mL (Biotin)

Creatine Kinase M-Type Polyclonal Conjugated Antibody

Ask
View Details