Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EpCAM/TROP1/CD326 (C-Fc)

Source: Human Cells. MW :54.5kD. Recombinant Human EpCAM is produced by our Mammalian expression system and the target gene encoding Gln24-Lys265 is expressed with a Fc tag at the C-terminus. Epithelial Cell Adhesion Molecule (EpCAM) is a signal type I transmembrane glycoprotein that belongs to the EPCAM family. EpCAM is composed of an extracellular domain with one thyroglobulin type-1 domain, a transmembrane domain and a cytoplasmic domain. EpCAM is found on the surface of adenocarcinoma, but not on mesodermal or neural cell membranes. The EpCAM molecule has been shown to function as a homophilic Ca2+ independent adhesion molecule. It may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium as an immunological barrier providing the first line of defense against infection. Defects in EPCAM are a cause of hereditary non-polyposis colorectal cancer type 8 (HNPCC8) and diarrhea type 5 (DIAR5) . EpCAM plays a role in embryonic stem cells proliferation and differentiation; it up-regulates the expression of FABP5, MYC and Cyclin A and Cyclin E. It is highly and selectively expressed by undifferentiated embryonic stem cells.

Product Specifications

Gene Name

EPCAM

Gene ID

4072

UniProt

P16422

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Rhodococcus sp. DNA repair protein recO (recO)
MBS1410595-01 0.02 mg (E-Coli)

Recombinant Rhodococcus sp. DNA repair protein recO (recO)

Ask
View Details
Recombinant Rhodococcus sp. DNA repair protein recO (recO)
MBS1410595-02 0.02 mg (Yeast)

Recombinant Rhodococcus sp. DNA repair protein recO (recO)

Ask
View Details
Recombinant Rhodococcus sp. DNA repair protein recO (recO)
MBS1410595-03 0.1 mg (E-Coli)

Recombinant Rhodococcus sp. DNA repair protein recO (recO)

Ask
View Details
Recombinant Rhodococcus sp. DNA repair protein recO (recO)
MBS1410595-04 0.1 mg (Yeast)

Recombinant Rhodococcus sp. DNA repair protein recO (recO)

Ask
View Details
Recombinant Rhodococcus sp. DNA repair protein recO (recO)
MBS1410595-05 0.02 mg (Baculovirus)

Recombinant Rhodococcus sp. DNA repair protein recO (recO)

Ask
View Details
Recombinant Rhodococcus sp. DNA repair protein recO (recO)
MBS1410595-06 0.02 mg (Mammalian-Cell)

Recombinant Rhodococcus sp. DNA repair protein recO (recO)

Ask
View Details