Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Endothelial Cell-Specific Molecule /Endocan/ESM-1 (C-6His)

Source: Human Cells. MW :19kD. Recombinant Mouse ESM-1 is produced by our Mammalian expression system and the target gene encoding Trp20-Arg184 is expressed with a 6His tag at the C-terminus. Endothelial cell-specific molecule–1 (ESM-1) —so-called endocan—is a novel endothelium derived soluble dermatan sulfate proteoglycan (PG) that is constitutively expressed by endothelial cells in lungs and kidneys and can be detected in human blood. It is encoded by the ESM1 gene. The expression of this gene is regulated by several cytokines and growth factors, such as vascular endothelial growth factor. Inflammatory cytokines, such as interleukin (IL) -1 beta and tumor necrosis factor (TNF) -a, stimulate the upregulation of endocan mRNA and the secretion of endocan from endothelial cells. The binding of circulating endocan to leukocyte ligand for ICAM-1—Lymphocyte Function-associated Antigen-1 (LFA-1) and to leukocyte ligand for VCAM-1—Very Late Antigen-4 (VLA-4) is important in leukocyte adhesion and interaction with activated endothelium. Endocan is a key player in the regulation of major processes such as cell adhesion in inflammatory disorders and tumor progression.

Product Specifications

Gene Name

Esm1

Gene ID

71690

UniProt

Q9QYY7

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desalkyl Ebastine
TRC-D288770-5MG 5 mg

Desalkyl Ebastine

Sign In for Pricing
View Details
IRS-2 Rabbit pAb, BF700 conjugated
orb2872005 100 µL

IRS-2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Porcine 5-hydroxy tryptamine (5-ht) ELISA Kit
NSL1437Po 96 Tests

Porcine 5-hydroxy tryptamine (5-ht) ELISA Kit

Sign In for Pricing
View Details
Human Thymopoietin (TMPO) ELISA Kit
EKU07664 96 Tests

Human Thymopoietin (TMPO) ELISA Kit

Sign In for Pricing
View Details
HS1BP3 (HCLS1-binding Protein 3, HS1-binding Protein 3, HSP1BP-3) (MaxLight 650)
MBS6222638-01 0.1 mL

HS1BP3 (HCLS1-binding Protein 3, HS1-binding Protein 3, HSP1BP-3) (MaxLight 650)

Sign In for Pricing
View Details
HS1BP3 (HCLS1-binding Protein 3, HS1-binding Protein 3, HSP1BP-3) (MaxLight 650)
MBS6222638-02 5x 0.1 mL

HS1BP3 (HCLS1-binding Protein 3, HS1-binding Protein 3, HSP1BP-3) (MaxLight 650)

Sign In for Pricing
View Details