Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Endothelial Cell-Specific Molecule /Endocan/ESM-1 (C-6His)

Source: Human Cells. MW :19kD. Recombinant Mouse ESM-1 is produced by our Mammalian expression system and the target gene encoding Trp20-Arg184 is expressed with a 6His tag at the C-terminus. Endothelial cell-specific molecule–1 (ESM-1) —so-called endocan—is a novel endothelium derived soluble dermatan sulfate proteoglycan (PG) that is constitutively expressed by endothelial cells in lungs and kidneys and can be detected in human blood. It is encoded by the ESM1 gene. The expression of this gene is regulated by several cytokines and growth factors, such as vascular endothelial growth factor. Inflammatory cytokines, such as interleukin (IL) -1 beta and tumor necrosis factor (TNF) -a, stimulate the upregulation of endocan mRNA and the secretion of endocan from endothelial cells. The binding of circulating endocan to leukocyte ligand for ICAM-1—Lymphocyte Function-associated Antigen-1 (LFA-1) and to leukocyte ligand for VCAM-1—Very Late Antigen-4 (VLA-4) is important in leukocyte adhesion and interaction with activated endothelium. Endocan is a key player in the regulation of major processes such as cell adhesion in inflammatory disorders and tumor progression.

Product Specifications

Gene Name

Esm1

Gene ID

71690

UniProt

Q9QYY7

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Polyclonal Antibody
RD82702A-01 60μL

CD19 Polyclonal Antibody

Sign In for Pricing
View Details
CD19 Polyclonal Antibody
RD82702A-02 120μL

CD19 Polyclonal Antibody

Sign In for Pricing
View Details
CD19 Polyclonal Antibody
RD82702A-03 200μL

CD19 Polyclonal Antibody

Sign In for Pricing
View Details
GRIN1 Antibody (Splice Variant C1)
MBS5313127-01 0.025 mg

GRIN1 Antibody (Splice Variant C1)

Sign In for Pricing
View Details
GRIN1 Antibody (Splice Variant C1)
MBS5313127-02 5x 0.025 mg

GRIN1 Antibody (Splice Variant C1)

Sign In for Pricing
View Details
Mouse Monoclonal NUDT21 Antibody (OTI13H1) - Azide and BSA Free
NBP2-73113 100 µg

Mouse Monoclonal NUDT21 Antibody (OTI13H1) - Azide and BSA Free

Sign In for Pricing
View Details