Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Endothelial Cell-Specific Molecule /Endocan/ESM-1 (C-6His)

Source: Human Cells. MW :19kD. Recombinant Mouse ESM-1 is produced by our Mammalian expression system and the target gene encoding Trp20-Arg184 is expressed with a 6His tag at the C-terminus. Endothelial cell-specific molecule–1 (ESM-1) —so-called endocan—is a novel endothelium derived soluble dermatan sulfate proteoglycan (PG) that is constitutively expressed by endothelial cells in lungs and kidneys and can be detected in human blood. It is encoded by the ESM1 gene. The expression of this gene is regulated by several cytokines and growth factors, such as vascular endothelial growth factor. Inflammatory cytokines, such as interleukin (IL) -1 beta and tumor necrosis factor (TNF) -a, stimulate the upregulation of endocan mRNA and the secretion of endocan from endothelial cells. The binding of circulating endocan to leukocyte ligand for ICAM-1—Lymphocyte Function-associated Antigen-1 (LFA-1) and to leukocyte ligand for VCAM-1—Very Late Antigen-4 (VLA-4) is important in leukocyte adhesion and interaction with activated endothelium. Endocan is a key player in the regulation of major processes such as cell adhesion in inflammatory disorders and tumor progression.

Product Specifications

Gene Name

Esm1

Gene ID

71690

UniProt

Q9QYY7

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GNAO1 Blocking Peptide
33R-7429 100 ug

GNAO1 Blocking Peptide

Ask
View Details
Rabbit Polyclonal TMEM128 Antibody [Alexa Fluor 350]
NBP2-98119AF350 0.1 mL

Rabbit Polyclonal TMEM128 Antibody [Alexa Fluor 350]

Ask
View Details
Recombinant Daucus carota Cytochrome c oxidase subunit 2 (COX2), partial
MBS7055832 Inquire

Recombinant Daucus carota Cytochrome c oxidase subunit 2 (COX2), partial

Ask
View Details
Lentiviral mouse Irf3 shRNA (UAS) - Lentiviral mouse Irf3 shRNA (UAS) plasmid
GTR15276211 1 Vial

Lentiviral mouse Irf3 shRNA (UAS) - Lentiviral mouse Irf3 shRNA (UAS) plasmid

Ask
View Details
LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI6D11]
TA809074S 30 µL

LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI6D11]

Ask
View Details
CD28 (T-cell-specific surface glycoprotein CD28, Tp44) (AP)
MBS6122693-01 0.1 mL

CD28 (T-cell-specific surface glycoprotein CD28, Tp44) (AP)

Ask
View Details