Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nephroblastoma Overexpressed Gene /NOV/CCN3/IGFBP-9 (C-6His)

Source: Human Cells. MW :39.1kD. Recombinant Mouse CCN3 is produced by our Mammalian expression system and the target gene encoding Ser26-Ile354 is expressed with a 6His tag at the C-terminus. NOV, also called CCN3, is a secreted protein of CCN family members. CCN family members are highly conserved cysteine rich proteins sharing a common modular structure having 4 conserved domains, insulin-like growth factor-binding protein (IGFBP) domain, von Willebrand type C (VWC) domain, thrombospondin-1 (TSP-1) domain, and C-terminal (CT) domain (absent in CCN5) . By specific interactions with these domains, CCN proteins modulate multiple signalling pathways including BMPs, Wnt, TGFs, Notch and integrins to regulate cell proliferation, differentiation, adhesion, migration, angiogenesis, and survival. CCN3 is firstly characterized as a promoter of progenitor activity of human hematopoietic stem cells, as knockdown of CCN3 can abrogate the function of primitive progenitors. Recent studies showed that CCN3 is also actively involved in the process of wound healing. CCN3 is highly expressed in granulation tissues of cutaneous wounds and capable of inducing synthetic responses of fibroblasts.

Product Specifications

Gene Name

Nov

Gene ID

18133

UniProt

Q64299

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEIVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal TFF1/pS2 Antibody (TFF1/1091) [DyLight 680]
NBP2-48010FR 0.1 mL

Mouse Monoclonal TFF1/pS2 Antibody (TFF1/1091) [DyLight 680]

Ask
View Details
Human Progesterone induced blocking factor, PIBF ELISA KIT
EA0083Hu-01 96 Well

Human Progesterone induced blocking factor, PIBF ELISA KIT

Ask
View Details
Human Progesterone induced blocking factor, PIBF ELISA KIT
EA0083Hu-02 5x 96 Tests

Human Progesterone induced blocking factor, PIBF ELISA KIT

Ask
View Details
Human Progesterone induced blocking factor, PIBF ELISA KIT
EA0083Hu-03 10x 96 Tests

Human Progesterone induced blocking factor, PIBF ELISA KIT

Ask
View Details
GDIA1 Polyclonal Antibody, Cy7 Conjugated
bs-5116R-Cy7 100 µL

GDIA1 Polyclonal Antibody, Cy7 Conjugated

Ask
View Details
OPSS-PEG-Mal, 6K
HE035022-6K Inquire

OPSS-PEG-Mal, 6K

Ask
View Details