Recombinant Mouse Ectodysplasin A2 Receptor/EDA2R/TNFRSF27 (C-6His)
Source: Human Cells. MW :16.4kD. Recombinant Mouse Ectodysplasin A2 Receptor is produced by our Mammalian expression system and the target gene encoding Met1-Thr138 is expressed with a 6His tag at the C-terminus. Tumor necrosis factor receptor superfamily member 27, also known as XEDAR and EDA2R, is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains 3 cysteine-rich repeats and a single transmembrane domain but lacks an N-terminal signal peptide. EDA2R, as well as its paralog, EDAR, binds the ectodysplasin ligands EDA-A2 and EDA-A1, which are two alternatively spliced forms of the EDA gene. Mutations in the EDA gene are associated with the X-linked form of Hypohidrotic Ectodermal Dysplasia (HED), a disease typically characterized by abnormal hair, teeth and sweat glands.
Product Specifications
Gene Name
Eda2r
Gene ID
245527
UniProt
Q8BX35
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRAQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREATVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items