Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ectodysplasin A2 Receptor/EDA2R/TNFRSF27 (C-Fc)

Source: Human Cells. MW :42.5kD. Recombinant Mouse Ectodysplasin A2 Receptor is produced by our Mammalian expression system and the target gene encoding Met1-Thr138 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 27, also known as XEDAR and EDA2R, is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains 3 cysteine-rich repeats and a single transmembrane domain but lacks an N-terminal signal peptide. EDA2R, as well as its paralog, EDAR, binds the ectodysplasin ligands EDA-A2 and EDA-A1, which are two alternatively spliced forms of the EDA gene. Mutations in the EDA gene are associated with the X-linked form of Hypohidrotic Ectodermal Dysplasia (HED), a disease typically characterized by abnormal hair, teeth and sweat glands.

Product Specifications

Gene Name

Eda2r

Gene ID

245527

UniProt

Q8BX35

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRAQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREATVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

GCK (G-6) Alexa Fluor® 647
sc-17819 AF647 200 µg/mL

GCK (G-6) Alexa Fluor® 647

Sign In for Pricing
View Details
Phospho-CREB (Ser121) BioAssayTM ELISA Kit
472960 2x 96 Tests

Phospho-CREB (Ser121) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
SERPINH1P1 3'UTR GFP Stable Cell Line
TU072978 1.0 mL

SERPINH1P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cryo Box (PP) 81 places for 1mL or 1.8 mL Cryo Vial
5050500/1 1 Each

Cryo Box (PP) 81 places for 1mL or 1.8 mL Cryo Vial

Sign In for Pricing
View Details
HSP90 antibody
10R-6731 100 ug

HSP90 antibody

Sign In for Pricing
View Details
Bovine Nerve Growth Factor ELISA Kit
MBS724951-01 48 Well

Bovine Nerve Growth Factor ELISA Kit

Sign In for Pricing
View Details