Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ectodysplasin A2 Receptor/EDA2R/TNFRSF27 (C-Fc)

Source: Human Cells. MW :42.5kD. Recombinant Mouse Ectodysplasin A2 Receptor is produced by our Mammalian expression system and the target gene encoding Met1-Thr138 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 27, also known as XEDAR and EDA2R, is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains 3 cysteine-rich repeats and a single transmembrane domain but lacks an N-terminal signal peptide. EDA2R, as well as its paralog, EDAR, binds the ectodysplasin ligands EDA-A2 and EDA-A1, which are two alternatively spliced forms of the EDA gene. Mutations in the EDA gene are associated with the X-linked form of Hypohidrotic Ectodermal Dysplasia (HED), a disease typically characterized by abnormal hair, teeth and sweat glands.

Product Specifications

Gene Name

Eda2r

Gene ID

245527

UniProt

Q8BX35

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRAQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREATVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EG629689 Mouse siRNA Oligo Duplex (Locus ID 629689)
SR416265 1 Kit

EG629689 Mouse siRNA Oligo Duplex (Locus ID 629689)

Ask
View Details
IL36RN siRNA (Mouse)
CRM5529-01 15 nmol

IL36RN siRNA (Mouse)

Ask
View Details
IL36RN siRNA (Mouse)
CRM5529-02 30 nmol

IL36RN siRNA (Mouse)

Ask
View Details
ETV6 (ETS-related Protein Tel1, Tel, ETS Translocation Variant 6, Transcription Factor ETV6, TEL, TEL1) (FITC)
126484-FITC 100 µL

ETV6 (ETS-related Protein Tel1, Tel, ETS Translocation Variant 6, Transcription Factor ETV6, TEL, TEL1) (FITC)

Ask
View Details
Lentiviral mouse Ism1 shRNA (UAS) - Lentiviral mouse Ism1 shRNA (UAS, iRFP) (25)
GTR15266006 1 Vial

Lentiviral mouse Ism1 shRNA (UAS) - Lentiviral mouse Ism1 shRNA (UAS, iRFP) (25)

Ask
View Details