Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon gamma/IFN-gamma

Source: Human Cells. MW :15.5kD. Recombinant Mouse Interferon gamma is produced by our Mammalian expression system and the target gene encoding His23-Cys155 is expressed. Mouse Ifng is a secreted protein which belongs to the type I I (or gamma) interferon family. IFNG is produced by lymphocytes and activated by specific antigens or mitogens. In addition to having antiviral activity, IFNG also has important immunoregulatory functions. It is a potent activator of macrophages and has antiproliferative effects on transformed cells. It can potentiate the antiviral and antitumor effects of the type I interferons. Genetic variation in IFNG is associated with the risk of aplastic anemia (AA) which is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.

Product Specifications

Gene Name

Ifng

Gene ID

15978

UniProt

P01580

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HES-6 Rabbit Polyclonal Antibody
APRab11995-01 20 µL

HES-6 Rabbit Polyclonal Antibody

Ask
View Details
HES-6 Rabbit Polyclonal Antibody
APRab11995-02 50 µL

HES-6 Rabbit Polyclonal Antibody

Ask
View Details
HES-6 Rabbit Polyclonal Antibody
APRab11995-03 100 µL

HES-6 Rabbit Polyclonal Antibody

Ask
View Details
HES-6 Rabbit Polyclonal Antibody
APRab11995-04 200 µL

HES-6 Rabbit Polyclonal Antibody

Ask
View Details
Mouse Monoclonal RBP4/Retinol-Binding Protein 4 Antibody (RBP4/4046) [Alexa Fluor 350]
NBP3-24345AF350 0.1 mL

Mouse Monoclonal RBP4/Retinol-Binding Protein 4 Antibody (RBP4/4046) [Alexa Fluor 350]

Ask
View Details
Anti-Phospho-CCND1-(T286) antibody
STJ29340 100 µl

Anti-Phospho-CCND1-(T286) antibody

Ask
View Details