Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-12/IL-12

Source: Human Cells. MW :57.5kD. Recombinant Mouse Interleukin-12 is produced by our Mammalian expression system and the target gene encoding Met23-Ser335&Arg23-Ala215 is expressed. IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN- gamma) and tumor necrosis factor-alpha (TNF- alpha) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN- gamma . T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity. IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes.

Product Specifications

Gene Name

Il12b

Gene ID

16160

UniProt

P43432

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS&RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-p84 Antibody
56248-1 100 µg

Anti-p84 Antibody

Ask
View Details
Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) AIM39 Polyclonal Antibody
MBS7168267 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) AIM39 Polyclonal Antibody

Ask
View Details
VCIP 135 (VCPIP1) (NM_025054) Human Over-expression Lysate
LC410929 20 µg

VCIP 135 (VCPIP1) (NM_025054) Human Over-expression Lysate

Ask
View Details
Pid1 Mouse shRNA Lentiviral Particle (Locus ID 98496)
TL505556V 500 µL Each

Pid1 Mouse shRNA Lentiviral Particle (Locus ID 98496)

Ask
View Details
Mouse Monoclonal TIMP-3 Antibody (MM0036-7D3) [DyLight 550]
NB110-61002R 0.1 mL

Mouse Monoclonal TIMP-3 Antibody (MM0036-7D3) [DyLight 550]

Ask
View Details