Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-12/IL-12

Source: Human Cells. MW :57.5kD. Recombinant Mouse Interleukin-12 is produced by our Mammalian expression system and the target gene encoding Met23-Ser335&Arg23-Ala215 is expressed. IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN- gamma) and tumor necrosis factor-alpha (TNF- alpha) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN- gamma . T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity. IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes.

Product Specifications

Gene Name

Il12b

Gene ID

16160

UniProt

P43432

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS&RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1066 sgRNA CRISPR Lentivector set (Mouse)
K4266601 3x 1.0 µg

Olfr1066 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Phospho-ALOX5 (Ser524) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-13777R-BF594 100 µL

Phospho-ALOX5 (Ser524) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
CDXA/NKX2 for Dual Luciferase Vectors (LR-2XXXD)
LR-2025D 1 Each

CDXA/NKX2 for Dual Luciferase Vectors (LR-2XXXD)

Sign In for Pricing
View Details
ZNF213 (Zinc Finger Protein 213, CR53, ZKSCAN21) (FITC)
253686-FITC 100 µL

ZNF213 (Zinc Finger Protein 213, CR53, ZKSCAN21) (FITC)

Sign In for Pricing
View Details
INPPL1 Protein Lysate (Mouse) with C-HA Tag
24988034 100 µg

INPPL1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral mouse Clic1 shRNA (UAS) - Lentiviral mouse Clic1 shRNA (UAS, GFP) (100)
GTR15249777 1 Vial

Lentiviral mouse Clic1 shRNA (UAS) - Lentiviral mouse Clic1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details