Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-12 Subunit beta/IL-12 p40/IL-12B (C-6His)

Source: Human Cells. MW :37.1kD. Recombinant Mouse Interleukin-12 subunit beta is produced by our Mammalian expression system and the target gene encoding Met23-Ser335 is expressed with a 6His tag at the C-terminus. Interleukin-12 subunit beta (IL-12B) belongs to the type I cytokine receptor family. It contains 1 fibronectin type-III domain and 1 Ig-like C2-type domain. IL-12B is a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. IL-12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor encoded by IL12B and a 35 kD subunit encoded by IL12A. IL12 is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. It has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen.

Product Specifications

Gene Name

Il12b

Gene ID

16160

UniProt

P43432

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Chymotrypsin-Like Elastase Family Member 3B (ELA3B) ELISA Kit
MBS7263564-01 48 Well

Bovine Chymotrypsin-Like Elastase Family Member 3B (ELA3B) ELISA Kit

Ask
View Details
Bovine Chymotrypsin-Like Elastase Family Member 3B (ELA3B) ELISA Kit
MBS7263564-02 96 Well

Bovine Chymotrypsin-Like Elastase Family Member 3B (ELA3B) ELISA Kit

Ask
View Details
Bovine Chymotrypsin-Like Elastase Family Member 3B (ELA3B) ELISA Kit
MBS7263564-03 5x 96 Well

Bovine Chymotrypsin-Like Elastase Family Member 3B (ELA3B) ELISA Kit

Ask
View Details
Bovine Chymotrypsin-Like Elastase Family Member 3B (ELA3B) ELISA Kit
MBS7263564-04 10x 96 Well

Bovine Chymotrypsin-Like Elastase Family Member 3B (ELA3B) ELISA Kit

Ask
View Details
NCOA3, NT (NCOA3, AIB1, BHLHE42, RAC3, TRAM1, Nuclear receptor coactivator 3, ACTR, Amplified in breast cancer 1 protein, CBP-interacting protein, Class E basic helix-loop-helix protein 42, Receptor-associated coactivator 3, Steroid receptor coactivator protein 3, Thyroid hormone receptor activator molecule 1) (AP) discontinued
038835-AP 200 µL

NCOA3, NT (NCOA3, AIB1, BHLHE42, RAC3, TRAM1, Nuclear receptor coactivator 3, ACTR, Amplified in breast cancer 1 protein, CBP-interacting protein, Class E basic helix-loop-helix protein 42, Receptor-associated coactivator 3, Steroid receptor coactivator protein 3, Thyroid hormone receptor activator molecule 1) (AP) discontinued

Ask
View Details
β-catenin (15B8) : m-IgG Fc BP-HRP Bundle
sc-526817 1 Kit

β-catenin (15B8) : m-IgG Fc BP-HRP Bundle

Ask
View Details