Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PD-L1/B7-H1/CD274 (C-Flag)

Source: Human Cells. MW :26.3kD. Recombinant Human Programmed Cell Death 1 Ligand 1 is produced by our Mammalian expression system and the target gene encoding Phe19-Thr239 is expressed with a Flag tag at the C-terminus. CD274, also known as B7-H1 or programmed death ligand 1 (PD-L1), is a 40 kD type I transmembrane protein and a member of the B7 family within the immunoglobulin receptor superfamily. Programmed death-1 ligand-1 (PD-L1, CD274, B7-H1) has been identified as the ligand for the immunoinhibitory receptor programmed death-1 (PD1/PDCD1) and has been demonstrated to play a role in the regulation of immune responses and peripheral tolerance. By binding to PD1 on activated T-cells and B-cells, PD-L1 may inhibit ongoing T-cell responses by inducing apoptosis and arresting cell-cycle progression. Accordingly, it leads to growth of immunogenic tumor growth by increasing apoptosis of antigen specific T cells and may contribute to immune evasion by cancers. PD-L1 thus is regarded as promising therapeutic target for human autoimmune disease and malignant cancers.

Product Specifications

Gene Name

CD274

Gene ID

29126

UniProt

Q9NZQ7

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB 150mM Nacl pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTDYKDDDDK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat CASP7 (Caspase 7) ELISA Kit
MBS2514586-01 24 Tests (Limit 1)

Rat CASP7 (Caspase 7) ELISA Kit

Ask
View Details
Rat CASP7 (Caspase 7) ELISA Kit
MBS2514586-02 48 Tests

Rat CASP7 (Caspase 7) ELISA Kit

Ask
View Details
Rat CASP7 (Caspase 7) ELISA Kit
MBS2514586-03 96 Tests

Rat CASP7 (Caspase 7) ELISA Kit

Ask
View Details
Rat CASP7 (Caspase 7) ELISA Kit
MBS2514586-04 5x 96 Tests

Rat CASP7 (Caspase 7) ELISA Kit

Ask
View Details
Rat CASP7 (Caspase 7) ELISA Kit
MBS2514586-05 10x 96 Tests

Rat CASP7 (Caspase 7) ELISA Kit

Ask
View Details
RXRB (Retinoid X Receptor, beta, DAUDI6, H-2RIIBP, MGC1831, NR2B2, RCoR-1) (FITC)
MBS6177886-01 0.1 mL

RXRB (Retinoid X Receptor, beta, DAUDI6, H-2RIIBP, MGC1831, NR2B2, RCoR-1) (FITC)

Ask
View Details