Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Tryptophan Synthase a Chain/Trp A

Source: E.coli. MW :28.7kD. Recombinant E.coli Tryptophan synthase alpha chain is produced by our E.coli expression system and the target gene encoding Met1-Ser268 is expressed. Tryptophan synthase is an enzyme that catalyzes the final two steps in the biosynthesis of tryptophan. It is commonly found in Eubacteria, Archaebacteria, Protista, Fungi, and Plantae, but is absent from animals such as humans. Tryptophan synthase typically exists as an a- beta beta-a complex.The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate: L-serine + 1-C- (indol-3-yl) glycerol 3-phosphate = L-tryptophan + D-glyceraldehyde 3-phosphate + H2O.The beta subunits catalyze the irreversible condensation of indole and serine to form tryptophan in a pyridoxal phosphate (PLP) dependent reaction. Their assembly into a complex leads to structural changes in both subunits resulting in reciprocal activation.

Product Specifications

Gene Name

TrpA

Gene ID

946204

UniProt

P0A877

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein SOX-15 (SOX15) Human ELISA Kit
G4195 96 Tests

Protein SOX-15 (SOX15) Human ELISA Kit

Sign In for Pricing
View Details
1- (2-Fluoro-3-pyridyl) cyclopropanecarboxylic acid
PC520382 1 Each

1- (2-Fluoro-3-pyridyl) cyclopropanecarboxylic acid

Sign In for Pricing
View Details
Mouse LRRC4C shRNA Plasmid
abx982527-01 150 µg

Mouse LRRC4C shRNA Plasmid

Sign In for Pricing
View Details
Mouse LRRC4C shRNA Plasmid
abx982527-02 300 µg

Mouse LRRC4C shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri rpsH Protein (aa 1-132) (strain NBRC 12016)
VAng-Lsx9789-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Kluyveri rpsH Protein (aa 1-132) (strain NBRC 12016)

Sign In for Pricing
View Details
GRIK5 Blocking Peptide
33R-2313 0.1 mg

GRIK5 Blocking Peptide

Sign In for Pricing
View Details