Recombinant Human Brain Natriuretic Peptide/BNP (N-6His-Flag)
Source: E.coli. MW :11kD. Recombinant Human Brain-type Natriuretic Peptide is produced by our E.coli expression system and the target gene encoding His27-Arg102 is expressed with a 6His, Flag tag at the N-terminus. Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.
Product Specifications
Gene Name
NPPB
Gene ID
4879
UniProt
P16860
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MNHKVHHHHHHMDYKDDDDKHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog