Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain Natriuretic Peptide/BNP (N-6His-Flag)

Source: E.coli. MW :11kD. Recombinant Human Brain-type Natriuretic Peptide is produced by our E.coli expression system and the target gene encoding His27-Arg102 is expressed with a 6His, Flag tag at the N-terminus. Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.

Product Specifications

Gene Name

NPPB

Gene ID

4879

UniProt

P16860

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMDYKDDDDKHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PPOX (NM_000309) Human Tagged ORF Clone Lentiviral Particle
RC201788L3V 200 µL

PPOX (NM_000309) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse Monoclonal IgE Antibody (4H10) [HRP]
NB500-472H 0.1 mL

Mouse Monoclonal IgE Antibody (4H10) [HRP]

Ask
View Details
ZNF133 (Zinc Finger Protein 133, Zinc Finger Protein 150, ZNF150, pHZ-13, pHZ-66) (MaxLight 405) discontinued
135599-ML405 100 µL

ZNF133 (Zinc Finger Protein 133, Zinc Finger Protein 150, ZNF150, pHZ-13, pHZ-66) (MaxLight 405) discontinued

Ask
View Details
Recombinant Hoplobatrachus tigerinus Tigerinin-1
MBS1173880-01 0.05 mg (E-Coli)

Recombinant Hoplobatrachus tigerinus Tigerinin-1

Ask
View Details
Recombinant Hoplobatrachus tigerinus Tigerinin-1
MBS1173880-02 0.2 mg (E-Coli)

Recombinant Hoplobatrachus tigerinus Tigerinin-1

Ask
View Details
Recombinant Hoplobatrachus tigerinus Tigerinin-1
MBS1173880-03 0.5 mg (E-Coli)

Recombinant Hoplobatrachus tigerinus Tigerinin-1

Ask
View Details