Recombinant Human Follicle-Stimulating Hormone a/ beta Dimer

Source: Human Cells. MW :10.2&12.5kD. Recombinant Human Follicle-Stimulating Hormone is produced by our Mammalian expression system and the target gene encoding Ala25-Ser116&Asn19-Glu129 is expressed. Human Follicle-stimulating hormone (FSH) is a member of glycoprotein hormones subunit beta family, whichalso includes LH, chorionic gonadotropin (CG) and thyroid-stimulating hormone (TSH) . FSH and its familymembers are heterodimers consisting of non-covalently linked a- and beta-subunits. They share an identical asubunit, and beta-subunits vary. FSH has a unique beta-subunit (FSH beta), which confers its specific biologic activityand is responsible for interaction with the FSH-receptor which belongs to a subfamily of GPCRs calledleucine-rich-repeat-containing GPCRs (LGRs) . FSH is secreted from the pituitary gland and regulatesreproduction in mammals. FSH stimulates sertoli cell proliferation in testes and supports spermatogenesis inmales, and induces the maturation of ovarian follicles in females.

Product Specifications

Gene Name

CGA

Gene ID

1081

UniProt

P01215&P01225

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE