Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli RNA Pyrophosphohydrolase/rppH

Source: E.coli. MW :20.8kD. Recombinant E.coli RNA pyrophosphohydrolase is produced by our E.coli expression system and the target gene encoding Met1-Gly176 is expressed. Messenger RNA (mRNA) degradation plays a key role in the control of gene expression in all organisms by limiting the number of times that each mRNA molecule can be used as a template for protein synthesis. RNA pyrophosphohydrolase, also called RppH, is a master regulator of 5'-dependent mRNA decay. It accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage. RppH preferentially hydrolyzes diadenosine penta-phosphate with ATP as one of the reaction products, and can be able to hydrolyze diadenosine hexa- and tetra-phosphate. However, this protein has no activity on diadenosine tri-phosphate, ADP-ribose, NADH and UDP-glucose. In the meningitis causing strain E.coli K1, it has been shown to play a role in HBMEC (human brain microvascular endothelial cells) invasion in vitro.

Product Specifications

Gene Name

RppH

Gene ID

947300

UniProt

P0A776

Components

Supplied as a 0.2 μm filtered solution of 50mM Tris, 500mM NaCl, 10% glycerol, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF829, ID (ZNF829, Zinc finger protein 829) (MaxLight 650)
MBS6367853-01 0.1 mL

ZNF829, ID (ZNF829, Zinc finger protein 829) (MaxLight 650)

Ask
View Details
ZNF829, ID (ZNF829, Zinc finger protein 829) (MaxLight 650)
MBS6367853-02 5x 0.1 mL

ZNF829, ID (ZNF829, Zinc finger protein 829) (MaxLight 650)

Ask
View Details
FAM23A Polyclonal Antibody
MBS9235296-01 0.1 mL

FAM23A Polyclonal Antibody

Ask
View Details
FAM23A Polyclonal Antibody
MBS9235296-02 5x 0.1 mL

FAM23A Polyclonal Antibody

Ask
View Details
1-Benzyl-4-piperidine-carboxaldehyde
TRC-B288620-10G 10 g

1-Benzyl-4-piperidine-carboxaldehyde

Ask
View Details
Bovine Uncharacterized Protein C7orf31 (C7ORF31) ELISA Kit
OM620008 96 Strip Well

Bovine Uncharacterized Protein C7orf31 (C7ORF31) ELISA Kit

Ask
View Details