Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius Auratus Leptin (N-8His)

Source: E.coli. MW :18.3kD. Recombinant Carassiusauratus Leptin is produced by our Yeast expression system and the target gene encoding Pro22-Cys171 is expressed with a 8His tag at the N-terminus. Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. In mammals, leptin is mainly produced by the adipose tissue and encodes body fat reserves, acting as a short-term satiety signal. In fish, the presence of a leptin-like peptide was first evidenced by immuno-cross-reactivity [14], and its existence was certainly demonstrated after the finding by synteny of a leptin sequence in the pufferfish.

Product Specifications

Gene Name

Ob

UniProt

B8YI02

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHPVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF629 siRNA (Mouse)
MBS8212209-01 15 nmol

ZNF629 siRNA (Mouse)

Ask
View Details
ZNF629 siRNA (Mouse)
MBS8212209-02 30 nmol

ZNF629 siRNA (Mouse)

Ask
View Details
ZNF629 siRNA (Mouse)
MBS8212209-03 5x 30 nmol

ZNF629 siRNA (Mouse)

Ask
View Details
Timm10b Rat shRNA Plasmid (Locus ID 84384)
TL711804 1 Kit

Timm10b Rat shRNA Plasmid (Locus ID 84384)

Ask
View Details
PE-Cy5 anti-mouse CD45RB
MBS9472156-01 25 Tests

PE-Cy5 anti-mouse CD45RB

Ask
View Details
PE-Cy5 anti-mouse CD45RB
MBS9472156-02 100 Tests

PE-Cy5 anti-mouse CD45RB

Ask
View Details