Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius Auratus Leptin (N-8His)

Source: E.coli. MW :18.3kD. Recombinant Carassiusauratus Leptin is produced by our Yeast expression system and the target gene encoding Pro22-Cys171 is expressed with a 8His tag at the N-terminus. Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. In mammals, leptin is mainly produced by the adipose tissue and encodes body fat reserves, acting as a short-term satiety signal. In fish, the presence of a leptin-like peptide was first evidenced by immuno-cross-reactivity [14], and its existence was certainly demonstrated after the finding by synteny of a leptin sequence in the pufferfish.

Product Specifications

Gene Name

Ob

UniProt

B8YI02

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHPVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TP53INP1 Peptide - N-terminal region
MBS3249927-01 0.1 mg

TP53INP1 Peptide - N-terminal region

Ask
View Details
TP53INP1 Peptide - N-terminal region
MBS3249927-02 5x 0.1 mg

TP53INP1 Peptide - N-terminal region

Ask
View Details
SRTD3, NT (SERTAD3, RBT1, SERTA domain-containing protein 3, Replication protein-binding trans-activator) (Biotin)
MBS6351270-01 0.2 mL

SRTD3, NT (SERTAD3, RBT1, SERTA domain-containing protein 3, Replication protein-binding trans-activator) (Biotin)

Ask
View Details
SRTD3, NT (SERTAD3, RBT1, SERTA domain-containing protein 3, Replication protein-binding trans-activator) (Biotin)
MBS6351270-02 5x 0.2 mL

SRTD3, NT (SERTAD3, RBT1, SERTA domain-containing protein 3, Replication protein-binding trans-activator) (Biotin)

Ask
View Details
4- (4-Bromophenyl) -2-hydroxythiazole
sc-232227 5 g

4- (4-Bromophenyl) -2-hydroxythiazole

Ask
View Details
pCR4-TOPO-RPS6KA6 Plasmid
PVT32661 2 µg

pCR4-TOPO-RPS6KA6 Plasmid

Ask
View Details